![]() |
1506: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
|
Summary
Name: | 1506: Revisiting Puzzle 59: TCR Binding Protein |
---|---|
Status: | Closed |
Created: | 04/09/2018 |
Points: | 100 |
Expired: | 04/16/2018 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.