1506: Revisiting Puzzle 59: TCR Binding Protein Status: Closed

Summary

Name:	1506: Revisiting Puzzle 59: TCR Binding Protein
Status:	Closed
Created:	04/09/2018
Points:	100
Expired:	04/16/2018 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Categories:	Overall, Prediction

Top Groups

Top Evolvers

Top Soloists

Need this puzzle? Log in to download.  

Comments

No comments yet.