puzzle picture
1486: Revisiting Puzzle 165: Rosetta Model 15
Status: Closed

Summary

Name: 1486: Revisiting Puzzle 165: Rosetta Model 15
Status: Closed
Created: 02/20/2018
Points: 100
Expired: 02/28/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,202100
2Go Science10,11471
3Gargleblasters10,07749
4Marvin's bunch10,01533
5Void Crushers9,95222

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons