puzzle picture
1480: Revisiting Puzzle 153: Rosetta Decoy 13
Status: Closed

Summary

Name: 1480: Revisiting Puzzle 153: Rosetta Decoy 13
Status: Closed
Created: 02/07/2018
Points: 100
Expired: 02/14/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,050100
2Anthropic Dreams10,02276
3Go Science10,01256
4Contenders10,00541
5Marvin's bunch9,99129

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 1 1 Beta Folders10,050100
2eusair 67 48  10,04497
3bertro 30 6 Beta Folders10,03495
4Waya 13 18 Anthropic Dreams10,01692
5ZeroLeak7 24 8 Go Science10,01289


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons