![]() |
1477: Revisiting Puzzle 150: Rosetta Decoy 12
Status: Closed
|
Summary
Name: | 1477: Revisiting Puzzle 150: Rosetta Decoy 12 |
---|---|
Status: | Closed |
Created: | 01/31/2018 |
Points: | 100 |
Expired: | 02/07/2018 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.