puzzle picture
1468: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Closed

Summary

Name: 1468: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Closed
Created: 01/09/2018
Points: 100
Expired: 01/17/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,794100
2Anthropic Dreams9,78974
3Gargleblasters9,78954
4Go Science9,77438
5L'Alliance Francophone9,77227

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons