![]() |
1468: Revisiting Puzzle 146: Rosetta Decoy 9
Status: Closed
|
Summary
Name: | 1468: Revisiting Puzzle 146: Rosetta Decoy 9 |
---|---|
Status: | Closed |
Created: | 01/09/2018 |
Points: | 100 |
Expired: | 01/17/2018 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.