puzzle picture
1451: Splicing Factor
Status: Closed

Summary

Name: 1451: Splicing Factor
Status: Closed
Created: 11/16/2017
Points: 100
Expired: 11/21/2017 - 03:00
Difficulty: Intermediate
Description: This protein is involved in transcription regulation and gene expression. It is also associated with both colorectal and liver cancer.
Categories: Pilot

Top Groups

RankGroupScorePoints
1Go Science9,446100
2Anthropic Dreams9,32973
3Gargleblasters9,22052
4Marvin's bunch9,18336
5Contenders9,15824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

frood66's picture
User offline. Last seen 56 min 30 sec ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
sequence not given - so here it is

GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons