![]() |
1451: Splicing Factor
Status: Closed
|
Summary
Name: | 1451: Splicing Factor |
---|---|
Status: | Closed |
Created: | 11/16/2017 |
Points: | 100 |
Expired: | 11/21/2017 - 03:00 |
Difficulty: | Intermediate |
Description: | This protein is involved in transcription regulation and gene expression. It is also associated with both colorectal and liver cancer. |
Categories: | Pilot |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ