Summary

Name:	1451: Splicing Factor
Status:	Closed
Created:	11/16/2017
Points:	100
Expired:	11/21/2017 - 03:00
Difficulty:	Intermediate
Description:	This protein is involved in transcription regulation and gene expression. It is also associated with both colorectal and liver cancer.
Categories:	Pilot

Top Groups

Rank	Group	Score	Points
1	Go Science	9,446	100
2	Anthropic Dreams	9,329	73
3	Gargleblasters	9,220	52
4	Marvin's bunch	9,183	36
5	Contenders	9,158	24

Rank	Player	Group	Score	Points
1	Azukay 79 1423	Go Science	9,446	100
2	Maerlyn138 55 482	Go Science	9,444	97
3	toshiue 11 48	Go Science	9,440	94
4	Bruno Kestemont 3 6	Go Science	9,418	90
5	ZeroLeak7 79 1423	Go Science	9,400	87

Rank	Player	Group	Score	Points
1	Bruno Kestemont 3 6	Go Science	9,435	100
2	Susume 79 376	Anthropic Dreams	9,312	97
3	grogar7 59 17	Anthropic Dreams	9,308	94
4	caglar 79 1423	Go Science	9,296	90
5	ZeroLeak7 79 1423	Go Science	9,265	87

Need this puzzle? Log in to download.

Fri, 11/17/2017 - 18:17

Offline

Joined: 09/20/2011

Groups: Marvin's bunch

sequence not given - so here it is

GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics


	Top New Users jb3 henrygi poiuy mattyg2009 ShreyaPamu