|
1451: Splicing Factor
Status: Closed
|
Summary
| Name: | 1451: Splicing Factor |
|---|---|
| Status: | Closed |
| Created: | 11/16/2017 |
| Points: | 100 |
| Expired: | 11/21/2017 - 03:00 |
| Difficulty: | Intermediate |
| Description: | This protein is involved in transcription regulation and gene expression. It is also associated with both colorectal and liver cancer. |
| Categories: | Pilot |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ