Summary

Name:	1451: Splicing Factor
Status:	Closed
Created:	11/16/2017
Points:	100
Expired:	11/21/2017 - 03:00
Difficulty:	Intermediate
Description:	This protein is involved in transcription regulation and gene expression. It is also associated with both colorectal and liver cancer.
Categories:	Pilot

Top Groups

Rank	Group	Score	Points
1	Go Science	9,446	100
2	Anthropic Dreams	9,329	73
3	Gargleblasters	9,220	52
4	Marvin's bunch	9,183	36
5	Contenders	9,158	24

Rank	Player	Group	Score	Points
1	Azukay 45 1449	Go Science	9,446	100
2	Maerlyn138 45 1449	Go Science	9,444	97
3	toshiue 45 858	Go Science	9,440	94
4	Bruno Kestemont 2 2	Go Science	9,418	90
5	ZeroLeak7 45 242	Go Science	9,400	87

Rank	Player	Group	Score	Points
1	Bruno Kestemont 2 2	Go Science	9,435	100
2	Susume 45 199	Anthropic Dreams	9,312	97
3	grogar7 45 19	Anthropic Dreams	9,308	94
4	caglar 45 1449	Go Science	9,296	90
5	ZeroLeak7 45 242	Go Science	9,265	87

Need this puzzle? Log in to download.

Fri, 11/17/2017 - 18:17

Offline

Joined: 09/20/2011

Groups: Marvin's bunch

sequence not given - so here it is

GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Happy few Gold players in History Foldit Newsletters Allow tweaks to foldit behavior with files in linux to meet the requirement of package managers Office Hours Coronavirus Puzzle


	Top New Users Danilo Gayagoy elainec SemperRabbit Scytrogen jereau1999