![]() |
1442: Sketchbook Puzzle - Revisiting Puzzle 136
Status: Closed
|
Summary
Name: | 1442: Sketchbook Puzzle - Revisiting Puzzle 136 |
---|---|
Status: | Closed |
Created: | 10/19/2017 |
Points: | 100 |
Expired: | 10/27/2017 - 18:00 |
Difficulty: | Intermediate |
Description: | This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence: ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT |
Categories: | Pilot |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.