![]() |
1414: Unsolved De-novo 114
Status: Closed
|
Summary
Name: | 1414: Unsolved De-novo 114 |
---|---|
Status: | Closed |
Created: | 08/09/2017 |
Points: | 100 |
Expired: | 08/16/2017 - 23:00 |
Difficulty: | Intermediate |
Description: | The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.
Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.