![]() |
1409: Revisiting Puzzle 135: E. coli
Status: Closed
|
Summary
Name: | 1409: Revisiting Puzzle 135: E. coli |
---|---|
Status: | Closed |
Created: | 07/27/2017 |
Points: | 100 |
Expired: | 08/03/2017 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.