puzzle picture
Test: Sketchbook Puzzle 1381!
Status: Closed

Summary

Name: Test: Sketchbook Puzzle 1381!
Status: Closed
Created: 07/24/2017
Points: 0
Expired: 07/28/2017 - 23:00
Difficulty: Intermediate
Description: Here we revisit puzzle 1381: Unsolved De-novo Freestyle 105 but with a twist... You have 40 moves at your disposal. Make them count! TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE (Testing the move count limit)
Categories:

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,4770
2Contenders9,0330
3Beta Folders8,9330
4Go Science8,8070
5L'Alliance Francophone8,6740

Top Soloists



Need this puzzle? Log in to download.  

Comments

bertro's picture
User offline. Last seen 2 days 4 hours ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
Cannot even use the Rama Map

, too many moves moving one segment around!

bertro's picture
User offline. Last seen 2 days 4 hours ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
Cuts are doubly penalized

Once making the cut and again when removing the cut. I suggest only when making is enough.

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons