puzzle picture
1391: Revisiting Puzzle 115: Exocyst
Status: Closed

Summary

Name: 1391: Revisiting Puzzle 115: Exocyst
Status: Closed
Created: 06/15/2017
Points: 100
Expired: 06/22/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters9,614100
2Anthropic Dreams9,61371
3Void Crushers9,60949
4Go Science9,60833
5Beta Folders9,59622

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Supported by: UW Center for Game Science, UW Department of Computer Science and Engineering, UW Baker Lab, VU Meiler Lab,
DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons