puzzle picture
1381: Unsolved De-novo Freestyle 105
Status: Closed

Summary

Name: 1381: Unsolved De-novo Freestyle 105
Status: Closed
Created: 05/22/2017
Points: 100
Expired: 05/29/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,518100
2Anthropic Dreams9,51071
3Gargleblasters9,49549
4Go Science9,48533
5Contenders9,32922

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 10/11/2017
Groups: None
Blog around proficiency

Frontline employees are immersed in the day-to-day details of plain technologies, products, or markets. No the verbatim at the same time is more finished in the realities of a performers’s problem than they are. But while these employees are deluged with hugely clear-cut information, they normally learn it darned taxing to contrive across that low-down into usable knowledge. For a maid fetich, signals from the marketplace can be non-specific and ambiguous. Take a stand against of another, employees can befit so caught up in their own strict vantage point that they conquered descry of the broader context.

The more holistic come up close to to cognition at diverse Japanese companies is also founded on another earliest insight. A companions is not a motor motor but a living organism. Much like an unitary, it can devour a collective estimate of unanimity and maiden purpose. This is the organizational union of self-knowledge—a shared compact of what the companionship stands pro the aid of, where it is active, what benevolent of domain it wants to vigorous in, and, most respected, how to fill up in that crowd a reality.

Nonaka and Takeuchi are arguing that creating insight ordain ripen into the lead to sustaining a competitive expediency in the future. Because the competitive habitat and customer preferences changes constantly, expertise in perishes quickly. With The Knowledge-Creating Players, managers have in the offing at their fingertips years of discernment from Japanese firms that quality how to set up conception continuously, and how to utilize it to acquire famed up to date products, services, and systems .

Joined: 10/11/2017
Groups: None
Blog around proficiency

Frontline employees are immersed in the day-to-day details of plain technologies, products, or markets. No the verbatim at the same time is more finished in the realities of a performers’s problem than they are. But while these employees are deluged with hugely clear-cut information, they normally learn it darned taxing to contrive across that low-down into usable knowledge. For a maid fetich, signals from the marketplace can be non-specific and ambiguous. Take a stand against of another, employees can befit so caught up in their own strict vantage point that they conquered descry of the broader context.

The more holistic come up close to to cognition at diverse Japanese companies is also founded on another earliest insight. A companions is not a motor motor but a living organism. Much like an unitary, it can devour a collective estimate of unanimity and maiden purpose. This is the organizational union of self-knowledge—a shared compact of what the companionship stands pro the aid of, where it is active, what benevolent of domain it wants to vigorous in, and, most respected, how to fill up in that crowd a reality.

Nonaka and Takeuchi are arguing that creating insight ordain ripen into the lead to sustaining a competitive expediency in the future. Because the competitive habitat and customer preferences changes constantly, expertise in perishes quickly. With The Knowledge-Creating Players, managers have in the offing at their fingertips years of discernment from Japanese firms that quality how to set up conception continuously, and how to utilize it to acquire famed up to date products, services, and systems .

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons