puzzle picture
1376: Revisiting Puzzle 110: Turkey
Status: Closed

Summary

Name: 1376: Revisiting Puzzle 110: Turkey
Status: Closed
Created: 05/11/2017
Points: 100
Expired: 05/18/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,317100
2Anthropic Dreams9,30371
3Beta Folders9,29849
4Gargleblasters9,28333
5L'Alliance Francophone9,27622

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 03/05/2015
Groups: Gargleblasters
Scoreboards messed up on ALL puzzles

In game scoreboards not agreeing with puzzle page scores... again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons