puzzle picture
1376: Revisiting Puzzle 110: Turkey
Status: Closed

Summary

Name: 1376: Revisiting Puzzle 110: Turkey
Status: Closed
Created: 05/11/2017
Points: 100
Expired: 05/18/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,317100
2Anthropic Dreams9,30371
3Beta Folders9,29849
4Gargleblasters9,28333
5L'Alliance Francophone9,27622

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

actiasluna's picture
User offline. Last seen 13 hours 55 min ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
Scoreboards messed up on ALL puzzles

In game scoreboards not agreeing with puzzle page scores... again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons