puzzle picture
1366: Electron Density Practice: Cell Surface Marker
Status: Closed

Summary

Name: 1366: Electron Density Practice: Cell Surface Marker
Status: Closed
Created: 04/14/2017
Points: 0
Expired: 04/21/2017 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle was posted with an incorrect sequence and closed early. It is superseded by Puzzle 1366b.

This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
GTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT
Categories:

Top Groups

RankGroupScorePoints
1Gargleblasters9,1120
2L'Alliance Francophone8,4680
3Beta Folders7,4700
4Anthropic Dreams7,1660
5Go Science5,9000

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons