puzzle picture
1365: Revisiting Puzzle 95: Chicken
Status: Closed

Summary

Name: 1365: Revisiting Puzzle 95: Chicken
Status: Closed
Created: 04/13/2017
Points: 100
Expired: 04/20/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,488100
2Beta Folders9,47574
3Anthropic Dreams9,45754
4Go Science9,42438
5Void Crushers9,41427

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons