puzzle picture
1354: Revisiting Puzzle 91: Virus Protein
Status: Closed

Summary

Name: 1354: Revisiting Puzzle 91: Virus Protein
Status: Closed
Created: 03/15/2017
Points: 100
Expired: 03/23/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,604100
2Go Science9,56381
3Beta Folders9,52164
4Hun-Magyar Csapat9,51850
5Gargleblasters9,47439

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Supported by: UW Center for Game Science, UW Department of Computer Science and Engineering, UW Baker Lab, VU Meiler Lab,
DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons