![]() |
1348: Revisiting Puzzle 89 with Density: Cow Eye
Status: Closed
|
Summary
Name: | 1348: Revisiting Puzzle 89 with Density: Cow Eye |
---|---|
Status: | Closed |
Created: | 03/03/2017 |
Points: | 100 |
Expired: | 03/10/2017 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a repost of Puzzle 1345, now with an electron density map! This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1345.
Sequence:
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY
|
Categories: | Electron Density, Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.