![]() |
1330: Revisiting Puzzle 85: Cell Adhesion Protein
Status: Closed
|
Summary
Name: | 1330: Revisiting Puzzle 85: Cell Adhesion Protein |
---|---|
Status: | Closed |
Created: | 01/17/2017 |
Points: | 100 |
Expired: | 01/25/2017 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence: MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.