puzzle picture
1324: Revisiting Puzzle 83: Cardiotoxin
Status: Closed

Soloists

RankPlayerGroupScorePoints
126byewelt 51 1376  7,9361
127SaraL 51 1376 Gargleblasters7,9061
128AeonFluff 51 1376  7,8891
129martinf 51 1156  7,8711
130doctaven 51 1376 Team South Africa7,8591
131jackie123 51 1376  7,8391
132feand 51 1376  7,8321
133umisuke 51 1376  7,8131
134Moamen 51 1376  7,7471
135lamoille 51 1376 Anthropic Dreams7,7381
136JohnCena 51 1376  7,7371
137parsnip 51 1376  7,6781
138citric acid 51 1376  7,6751
139kiki233 51 1376  7,6681
140Brainiac_2017 51 1376  7,6291
141mirjamvandelft 51 1376  7,6131
142trentis1 51 1376  7,6021
143ZiiONIC 51 1376 Anthropic Dreams7,6001
144SurgicalMaster 51 1376  7,5951
145DamnitCats 51 1376  7,5951
146sor2018 51 1376  7,5891
147jarbolol15 51 1376  7,5621
148xrossy03 51 1376  7,5451
149.sr 51 1376  7,5451
150NotJim99 51 1376  7,5391


Need this puzzle? Log in to download.  

Comments

Joined: 06/24/2008
Groups: Void Crushers
Fliters

The filter seems to be toggling off when I do anything manually

gitwut's picture
User offline. Last seen 3 years 32 weeks ago. Offline
Joined: 05/18/2012
Groups: Contenders
Same as puzzle 1320

This is the same puzzle we just finished (1320)

bertro's picture
User offline. Last seen 1 year 1 week ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
The chains are a bit

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons