puzzle picture
1324: Revisiting Puzzle 83: Cardiotoxin
Status: Closed

Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 06/24/2008
Groups: Void Crushers
Fliters

The filter seems to be toggling off when I do anything manually

gitwut's picture
User offline. Last seen 3 years 32 weeks ago. Offline
Joined: 05/18/2012
Groups: Contenders
Same as puzzle 1320

This is the same puzzle we just finished (1320)

bertro's picture
User offline. Last seen 1 year 1 week ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
The chains are a bit

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons