![]() |
1320: Revisiting Puzzle 82: Cytotoxin
Status: Closed
|
Summary
Name: | 1320: Revisiting Puzzle 82: Cytotoxin |
---|---|
Status: | Closed |
Created: | 12/20/2016 |
Points: | 100 |
Expired: | 01/03/2017 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.