![]() |
1318: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed
|
Summary
Name: | 1318: Revisiting Puzzle 81: Calcium Ion Binding Protein |
---|---|
Status: | Closed |
Created: | 12/11/2016 |
Points: | 100 |
Expired: | 12/20/2016 - 23:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.