1308: Revisiting Puzzle 77: Copper Chaperone Status: Closed

Summary

Name:	1308: Revisiting Puzzle 77: Copper Chaperone
Status:	Closed
Created:	11/21/2016
Points:	100
Expired:	11/29/2016 - 23:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI
Categories:	Overall, Prediction

Top Groups

Top Evolvers

Top Soloists

Need this puzzle? Log in to download.  

Comments

No comments yet.