![]() |
1300: Revisiting Puzzle 75 with Density: Antifreeze Protein
Status: Closed
|
Summary
Name: | 1300: Revisiting Puzzle 75 with Density: Antifreeze Protein |
---|---|
Status: | Closed |
Created: | 10/24/2016 |
Points: | 100 |
Expired: | 11/02/2016 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
|
Categories: | Electron Density, Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.