puzzle picture
1298: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed

Summary

Name: 1298: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed
Created: 10/18/2016
Points: 100
Expired: 10/26/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,009100
2Contenders8,99980
3Go Science8,99163
4Beta Folders8,98949
5L'Alliance Francophone8,98937

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1markm457 82 1799 Anthropic Dreams9,001100
2Aubade01 82 44  9,00198
3johnmitch 82 9  8,99896
4Jim Fraser 82 1010 Contenders8,99494
5georg137 28 43 Contenders8,99492


Need this puzzle? Log in to download.  

Comments

Aubade01's picture
User offline. Last seen 6 hours 17 min ago. Offline
Joined: 10/12/2013
Groups: None
Puzzle 1278 score

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

>>>>> Aubade01 (Aubade00)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons