Sat, 10/08/2016 - 06:32
#2
High confidence
Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).
|
1293b: Dysferlin C2B Domain: Predicted Contacts
Status: Closed
|
Summary
| Name: | 1293b: Dysferlin C2B Domain: Predicted Contacts |
|---|---|
| Status: | Closed |
| Created: | 10/07/2016 |
| Points: | 100 |
| Expired: | 10/14/2016 - 23:00 |
| Difficulty: | Intermediate |
| Description: | Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.
This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291. Sequence:
DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD
|
| Categories: | Overall, Predicted Contacts, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
can we assume this is mostly but not 100% correct? Thanks