puzzle picture
1293: Dysferlin C2B Domain: Predicted Contacts
Status: Closed

Summary

Name: 1293: Dysferlin C2B Domain: Predicted Contacts
Status: Closed
Created: 10/07/2016
Points: 0
Expired: 10/14/2016 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle was mistakenly posted without a Contact Bonus filter. The puzzle has been closed and reposted as Puzzle 1293b.

This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.

Sequence:
DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD
Categories:

Top Groups

RankGroupScorePoints
1Beta Folders9,3580
2Anthropic Dreams9,2290
3Gargleblasters9,1420
4Void Crushers8,6390
5Contenders8,5620

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 10/30/2012
Groups: Beta Folders
no contact bonus score, its a

no contact bonus score, its a necessary reference point

bkoep's picture
User offline. Last seen 1 day 21 hours ago. Offline
Joined: 11/15/2012
Groups: None
Oops

Thanks for pointing this out! We'll have to repost the puzzle.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons