|
1293: Dysferlin C2B Domain: Predicted Contacts
Status: Closed
|
Summary
Name: |
1293: Dysferlin C2B Domain: Predicted Contacts |
Status: |
Closed |
Created: |
10/07/2016 |
Points: |
0 |
Expired: |
10/14/2016 - 23:00 |
Difficulty: |
Intermediate |
Description: |
Note: This puzzle was mistakenly posted without a Contact Bonus filter. The puzzle has been closed and reposted as Puzzle 1293b.
This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.
Sequence:
DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD
|
Categories: | |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
no contact bonus score, its a necessary reference point