1287: Revisiting Puzzle 71 with Density: Crystallin

Status: Closed

Summary

Name:	1287: Revisiting Puzzle 71 with Density: Crystallin
Status:	Closed
Created:	09/21/2016
Points:	100
Expired:	09/28/2016 - 18:00
Difficulty:	Intermediate
Description:	This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284. Sequence: MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE
Categories:	Electron Density, Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	13,776	100
2	Gargleblasters	13,775	80
3	Contenders	13,761	63
4	Anthropic Dreams	13,757	49
5	Go Science	13,752	37

Rank	Player	Group	Score	Points
1	LociOiling 2 1	Beta Folders	13,776	100
2	bertro 51 1376	Beta Folders	13,776	99
3	actiasluna 51 1376	Gargleblasters	13,775	97
4	smilingone 51 1376	Beta Folders	13,775	95
5	reefyrob 51 1376	Beta Folders	13,775	93

Rank	Player	Group	Score	Points
1	bertro 51 1376	Beta Folders	13,776	100
2	Aubade01 51 20		13,762	99
3	frood66 51 586	Gargleblasters	13,762	97
4	Bletchley Park 9 14	Contenders	13,761	95
5	tokens 51 1376	Anthropic Dreams	13,752	93

Need this puzzle? Log in to download.

Wed, 09/21/2016 - 20:38

Offline

Joined: 05/02/2011

Groups: Beta Folders

Really nice to give us this

Really nice to give us this ED, that will train the eye and tool usage for future ones.

Thanks

Wed, 09/21/2016 - 21:12

Offline

Joined: 09/20/2011

Groups: Marvin's bunch

appreciate this puzzle at this time.

I would like to know the level of cloud definition (for reference) I know others would too.

Fri, 09/23/2016 - 02:16

Offline

Joined: 03/05/2015

Groups: Gargleblasters

Thanks for the small ED ...

I'm still crappy at them, but sure this will help given time. More of the same for practice, please!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Foldit Newsletters We should make a science-y UI mod :DD for foldit RNA prediction through AI Office Hours Happy few Gold players in History


	Top New Users galbraith Benjamin_F naniewoo smol_boi_danno B. A. Beder