puzzle picture
1287: Revisiting Puzzle 71 with Density: Crystallin
Status: Closed

Summary

Name: 1287: Revisiting Puzzle 71 with Density: Crystallin
Status: Closed
Created: 09/21/2016
Points: 100
Expired: 09/28/2016 - 18:00
Difficulty: Intermediate
Description: This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.

Sequence:
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders13,776100
2Gargleblasters13,77580
3Contenders13,76163
4Anthropic Dreams13,75749
5Go Science13,75237

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

bertro's picture
User offline. Last seen 6 weeks 4 days ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
Really nice to give us this

Really nice to give us this ED, that will train the eye and tool usage for future ones.

Thanks

frood66's picture
User offline. Last seen 5 hours 29 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
appreciate this puzzle at this time.

I would like to know the level of cloud definition (for reference) I know others would too.

actiasluna's picture
User offline. Last seen 1 week 4 days ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
Thanks for the small ED ...

I'm still crappy at them, but sure this will help given time. More of the same for practice, please!

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons