|
|
|
1287: Revisiting Puzzle 71 with Density: Crystallin
Status: Closed
|
Summary
Name: |
1287: Revisiting Puzzle 71 with Density: Crystallin |
Status: |
Closed |
Created: |
09/21/2016 |
Points: |
100 |
Expired: |
09/28/2016 - 18:00 |
Difficulty: |
Intermediate |
Description: |
This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.
Sequence:
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE
|
Categories: | Electron Density, Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
|
|
|
|
|
|
|
|
|
|
|
|
Really nice to give us this ED, that will train the eye and tool usage for future ones.
Thanks