puzzle picture
1253: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed

Summary

Name: 1253: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
Created: 06/28/2016
Points: 100
Expired: 07/06/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,090100
2Void Crushers9,04171
3L'Alliance Francophone9,03149
4Beta Folders9,01133
5Gargleblasters9,00422

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons