puzzle picture
1247: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed

Summary

Name: 1247: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed
Created: 06/15/2016
Points: 100
Expired: 06/22/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,880100
2L'Alliance Francophone9,84774
3Go Science9,83754
4Void Crushers9,81938
5Gargleblasters9,81827

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Aubade01 68 46  9,933100
2gitwut 68 1814 Contenders9,88098
3pmdpmd 68 1814 L'Alliance Francophone9,84796
4johnmitch 68 34  9,83793
5mirp 31 74 Go Science9,83791


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons