puzzle picture
1243: Unsolved De-novo Freestyle 81
Status: Closed

Summary

Name: 1243: Unsolved De-novo Freestyle 81
Status: Closed
Created: 06/06/2016
Points: 100
Expired: 06/13/2016 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science8,683100
2Anthropic Dreams8,67576
3Contenders8,65956
4Beta Folders8,62641
5D001x Med Chem MOOC8,61029

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 01/01/2016
Groups: Gargleblasters
Rama?

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.

actiasluna's picture
User offline. Last seen 1 week 3 days ago. Offline
Joined: 03/05/2015
Groups: Gargleblasters
I have no Rama map either and am not on Devprev.

Could sure use it for this puzzle.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons