![]() |
1227: Unsolved De-novo Freestyle 78: Predicted Contacts
Status: Closed
|
Summary
Name: | 1227: Unsolved De-novo Freestyle 78: Predicted Contacts |
---|---|
Status: | Closed |
Created: | 05/02/2016 |
Points: | 100 |
Expired: | 05/09/2016 - 23:00 |
Difficulty: | Intermediate |
Description: | This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.
Sequence:
VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA
|
Categories: | Overall, Predicted Contacts, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.