puzzle picture
1218: Unsolved De-novo Freestyle 77
Status: Closed

Summary

Name: 1218: Unsolved De-novo Freestyle 77
Status: Closed
Created: 04/09/2016
Points: 100
Expired: 04/17/2016 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
51LEC Biochem 20165,8271
52CH 150 class5,6121
53DSN @ Home01

Top Evolvers

RankPlayerGroupScorePoints
51ManVsYard 46 1003 Gargleblasters8,81847
5201010011111 46 571 Go Science8,74246
53TomTaylor 46 1295 Contenders8,59245
54guineapig 17 14  8,17143

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 04/12/2016
Groups: None
COOL

COOL

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons