puzzle picture
1215: Unsolved De-novo Freestyle 76
Status: Closed

Summary

Name: 1215: Unsolved De-novo Freestyle 76
Status: Closed
Created: 04/02/2016
Points: 0
Expired: 04/09/2016 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Note: This puzzle was mistakenly posted with the incorrect sequence, and was taken down early. A corrected puzzle has been posted as Puzzle 1215b.

Sequence:
DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE
Categories:

Top Groups

RankGroupScorePoints
1Contenders9,2710
2L'Alliance Francophone9,1230
3Anthropic Dreams9,0810
4Go Science9,0750
5Beta Folders9,0610

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1gitwut 84 1792 Contenders9,2710
2tarimo 84 466  9,2530
3johnmitch 84 7  9,2520
4crpainter 84 18  9,1750
5dcrwheeler 84 6  9,1420


Need this puzzle? Log in to download.  

Comments

Susume's picture
User offline. Last seen 18 hours 59 min ago. Offline
Joined: 10/02/2011
Sequence does not match puzzle

The sequence given above does not match the puzzle. The actual sequence is:
TTRVRVVGNGKVVEVHVGPDGIEVNIVRNGRSETIREKGTGGPEELKRIMDKVRERGNGDPVVNEVVRVVRKIINE

bkoep's picture
User offline. Last seen 47 min 8 sec ago. Offline
Joined: 11/15/2012
Groups: None
Thanks for the notice!

The puzzle has been closed and reposted here. Sorry for any inconvenience!

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons