puzzle picture
1213: Revisiting Puzzle 144: Rosetta Decoy 8
Status: Closed

Summary

Name: 1213: Revisiting Puzzle 144: Rosetta Decoy 8
Status: Closed
Created: 03/30/2016
Points: 100
Expired: 04/06/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,475100
2Beta Folders10,46483
3L'Alliance Francophone10,45068
4Contenders10,44055
5Anthropic Dreams10,41544

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 10/23/2014
Groups: Contenders
Crashes

Three crashes in a 20 minutes period on this puzzle.

LociOiling's picture
User offline. Last seen 14 min 40 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
disulfide bug not fixed yet

The crashes aren't a surprise, since crashes with disulfide bridges have not been fixed yet. Unfortunately, the old version of the client won't work with this puzzle. Puzzle 1213 has a Rama map, which means old clients can't open it.

The only possible workaround is to avoid making any disulfide bridges until late in the game. If disulfides form, you may be able to break them by moving the sidechains apart. Freezing the sidechains should prevent the bridges from re-forming.

Joined: 09/24/2012
Groups: Go Science
or disabling filters

seems to work

johnmitch's picture
User offline. Last seen 2 hours 25 min ago. Offline
Joined: 12/28/2010
Groups: None
running win 10 main with

running win 10 main with filters on several clients without any crashes.

Susume's picture
User offline. Last seen 13 hours 20 min ago. Offline
Joined: 10/02/2011
Still crashes with filter off

Ran my 1207 test script on puzzle 1213 in main, with cysteines banded and filter off; crashed during wiggle after half an hour. No error in log.txt.

alcor29's picture
User offline. Last seen 7 hours 22 min ago. Offline
Joined: 11/16/2012
Crash with filter on

Running 3 disulfide bonds, main, Win 10, 64,(drw)

***** STARTING THREAD ActionGlobalMinimize
delta_score: 50.1436
Playing sound: 5
***** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize
delta_score: -356.433
Playing sound: 2
***** ENDING THREAD ActionGlobalMinimize
Tool on_action_complete called
***** STARTING THREAD ActionGlobalMinimize

UNHANDLED EXCEPTION
1: library_main +46812112 bytes (no line)
2: library_main +40217 bytes (no line)
3: library_main +44517492 bytes (no line)
4: library_main +25168 bytes (no line)
5: library_main +5509 bytes (no line)
6: library_main +42535263 bytes (no line)
7: library_main +41750807 bytes (no line)
8: library_main +41747510 bytes (no line)
9: library_main +41739662 bytes (no line)
10: library_main +37145835 bytes (no line)
11: library_main +37149947 bytes (no line)
12: library_main +33197162 bytes (no line)
13: library_main +33136830 bytes (no line)
14: library_main +5334996 bytes (no line)
15: library_main +5332860 bytes (no line)
16: library_main +4356837 bytes (no line)
17: library_main +4357291 bytes (no line)
18: BaseThreadInitThunk +36 bytes (no line)
19: RtlUnicodeStringToInteger +595 bytes (no line)
20: RtlUnicodeStringToInteger +542 bytes (no line)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons