puzzle picture
1210: Revisiting Puzzle 143: Rosetta Decoy 7
Status: Closed

Summary

Name: 1210: Revisiting Puzzle 143: Rosetta Decoy 7
Status: Closed
Created: 03/22/2016
Points: 100
Expired: 03/30/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders8,949100
2Go Science8,87781
3Void Crushers8,85464
4Anthropic Dreams8,84250
5L'Alliance Francophone8,80639

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

jamiexq's picture
User offline. Last seen 22 hours 3 min ago. Offline
Joined: 07/31/2011
puzzle comments says there is one cys bond in this puzzle

puzzle comments says there is one cys bond in this puzzle
I only see on cysteine in this puzzle, am I missing something? There is no way to form one cys bond here

bkoep's picture
User offline. Last seen 13 hours 52 min ago. Offline
Joined: 11/15/2012
Groups: None
Sorry!

The original puzzle description was incorrect for this puzzle. I have amended the puzzle description.

There is only one cysteine in this protein, so no disulfides can form!

Joined: 05/19/2009
Groups: Contenders
correct only 1 cys in there

Correct, I also only see one cysteine.

Joined: 05/19/2009
Groups: Contenders
The secnd cys was possibly

The secnd cys was possibly removed temporarily because of a bug in the client that causes crashes with cysteines.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons