puzzle picture
1209: Unsolved De-novo Freestyle 74
Status: Closed

Summary

Name: 1209: Unsolved De-novo Freestyle 74
Status: Closed
Created: 03/19/2016
Points: 100
Expired: 03/26/2016 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,196100
2Contenders9,19080
3Beta Folders9,15863
4Gargleblasters9,13749
5Bad Monkey9,11337

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 05/19/2009
Groups: Contenders
No Rama Map ?

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep's picture
User offline. Last seen 2 hours 51 min ago. Offline
Joined: 11/15/2012
Groups: None
Maybe in the future

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons