puzzle picture
1207: Revisiting Puzzle 142: Rosetta Decoy 6
Status: Closed

Summary

Name: 1207: Revisiting Puzzle 142: Rosetta Decoy 6
Status: Closed
Created: 03/15/2016
Points: 100
Expired: 03/23/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,251100
2Anthropic Dreams10,22881
3Go Science10,21165
4Contenders10,15252
5Void Crushers10,10041

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/21/2011
Groups: Void Crushers
Pls suspend this puzzle until crash fix is out

With all the crashing, I am not able to do this puzzle right.
Currently in top 10 but I am sure I would get at least 100 pts more if I could run all scripts without crashing

Joined: 04/19/2011
I second TvdL request...

the puzzle constantly crashing. The top was 15 minutes continuous running time. Initially I thought the problem was with my computer, but it seems others have the same difficulties.

It would be great suspending this puzzle till the crashing bug eliminated...

grogar7's picture
User offline. Last seen 1 day 11 hours ago. Offline
Joined: 10/03/2011
I agree

This puzzle should be suspended or deprecated. Those (like my team mate Galaxie) who have not accepted the update to main, are able to run this puzzle unimpeded. Those who did accept the update are crashing regularly on 1207. Seems unfair!

Joined: 03/05/2015
Groups: Gargleblasters
Maybe some help with that...

FYI - I'm running from a freshly installed (not updated to an existing) application running the updated Main and 1207 is stable for me. It's worth the time to do! Just be sure you save your active puzzles and share them with yourself, and save the options.txt and all.macro files (your recipes and settings) from the old version before ditching the old application and reinstalling.

(This is particularly important to do periodically on the Mac platform, in which Foldit gets "foldit bloat" - the application grows over time and things slow down.)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons