puzzle picture
1184: Revisiting Puzzle 134: Rice
Status: Closed

Summary

Name: 1184: Revisiting Puzzle 134: Rice
Status: Closed
Created: 01/19/2016
Points: 100
Expired: 01/27/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,006100
2Anthropic Dreams9,95978
3Void Crushers9,95460
4Contenders9,93745
5Gargleblasters9,92933

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 01/23/2016
Groups: None
i dont get it

it wont let me play all it is on all of them is picture >:(

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons