puzzle picture
1178: Revisiting Puzzle 125: Ice Binding
Status: Closed

Summary

Name: 1178: Revisiting Puzzle 125: Ice Binding
Status: Closed
Created: 01/05/2016
Points: 100
Expired: 01/13/2016 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,014100
2Beta Folders9,00476
3Italiani Al Lavoro8,97956
4Contenders8,97741
5Anthropic Dreams8,97629

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons