![]() |
1153: Revisiting Puzzle 97: Pig
Status: Closed
|
Summary
Name: | 1153: Revisiting Puzzle 97: Pig |
---|---|
Status: | Closed |
Created: | 10/27/2015 |
Points: | 100 |
Expired: | 11/04/2015 - 11:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.