puzzle picture
1149: Revisiting Puzzle 95: Chicken
Status: Closed

Summary

Name: 1149: Revisiting Puzzle 95: Chicken
Status: Closed
Created: 10/13/2015
Points: 100
Expired: 10/21/2015 - 11:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,328100
2Gargleblasters9,30182
3Beta Folders9,27766
4Anthropic Dreams9,25953
5Contenders9,20842

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 10/15/2015
Groups: None
hi

teach me how to play

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons