puzzle picture
1145: Unsolved De-novo Freestyle 58: Cell Membrane
Status: Closed

Summary

Name: 1145: Unsolved De-novo Freestyle 58: Cell Membrane
Status: Closed
Created: 10/05/2015
Points: 100
Expired: 10/12/2015 - 23:00
Difficulty: Intermediate
Description: This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.

Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,728100
2Beta Folders14,70278
3Contenders14,60060
4Gargleblasters14,59345
5L'Alliance Francophone14,59233

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

spvincent's picture
User offline. Last seen 1 hour 53 min ago. Offline
Joined: 12/07/2007
Groups: Contenders
Some bits like the C-terminus

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume's picture
User offline. Last seen 1 week 2 days ago. Offline
Joined: 10/02/2011
bonus for hydrogen bonds?

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons