1136: Revisiting Puzzle 90: Heliomicin Status: Closed

Summary

Name:	1136: Revisiting Puzzle 90: Heliomicin
Status:	Closed
Created:	09/07/2015
Points:	100
Expired:	09/16/2015 - 11:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Categories:	Overall, Prediction

Top Groups

Top Evolvers

Top Soloists

Need this puzzle? Log in to download.  

Comments

No comments yet.