puzzle picture
1136: Revisiting Puzzle 90: Heliomicin
Status: Closed

Summary

Name: 1136: Revisiting Puzzle 90: Heliomicin
Status: Closed
Created: 09/07/2015
Points: 100
Expired: 09/16/2015 - 11:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,266100
2Beta Folders9,24878
3Gargleblasters9,23060
4Contenders9,22145
5Void Crushers9,20633

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons