puzzle picture
1126: De-novo Freestyle 55
Status: Closed

Summary

Name: 1126: De-novo Freestyle 55
Status: Closed
Created: 08/14/2015
Points: 100
Expired: 08/21/2015 - 23:00
Difficulty: Intermediate
Description: Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.

Sequence:
WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders8,864100
2Go Science8,81577
3Anthropic Dreams8,81058
4Beta Folders8,72443
5Gargleblasters8,69331

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

wisky's picture
User offline. Last seen 1 hour 51 min ago. Offline
Joined: 07/13/2011
Contacts?

Any chance on getting a contact map after this? I <3 contact map puzzles

bkoep's picture
User offline. Last seen 1 hour 49 min ago. Offline
Joined: 11/15/2012
Groups: None
Probably not

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.

wisky's picture
User offline. Last seen 1 hour 51 min ago. Offline
Joined: 07/13/2011
Thanks!

Thanks for the reply, bkoep! Good link too :)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons