puzzle picture
1126: De-novo Freestyle 55
Status: Closed

Summary

Name: 1126: De-novo Freestyle 55
Status: Closed
Created: 08/14/2015
Points: 100
Expired: 08/21/2015 - 23:00
Difficulty: Intermediate
Description: Little is known about this protein, which was identified in the genome of D. piger. The PSIPRED secondary structure predictions are provided on the starting model.

Sequence:
WDGFDADSADLVEIIPDALPNKGDTVDVRNYSNDETTTCLVVSVTRNSRTVEIVVRTPDGEAHTLVMEGR
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders8,864100
2Go Science8,81577
3Anthropic Dreams8,81058
4Beta Folders8,72443
5Gargleblasters8,69331

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

wisky's picture
User offline. Last seen 19 weeks 4 days ago. Offline
Joined: 07/13/2011
Contacts?

Any chance on getting a contact map after this? I <3 contact map puzzles

bkoep's picture
User offline. Last seen 11 hours 20 min ago. Offline
Joined: 11/15/2012
Groups: None
Probably not

Unfortunately, we only know of a few proteins that are homologous to this one. We need a large number of homologous sequences for covariance analysis, which is how we typically predict residue-residue contacts.

wisky's picture
User offline. Last seen 19 weeks 4 days ago. Offline
Joined: 07/13/2011
Thanks!

Thanks for the reply, bkoep! Good link too :)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons