![]() |
1124: Revisiting Puzzle 86: Nematode
Status: Closed
|
Summary
Name: | 1124: Revisiting Puzzle 86: Nematode |
---|---|
Status: | Closed |
Created: | 08/11/2015 |
Points: | 100 |
Expired: | 08/18/2015 - 11:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence: KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Have a nice day