puzzle picture
1124: Revisiting Puzzle 86: Nematode
Status: Closed

Summary

Name: 1124: Revisiting Puzzle 86: Nematode
Status: Closed
Created: 08/11/2015
Points: 100
Expired: 08/18/2015 - 11:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,031100
2Gargleblasters9,98377
3Beta Folders9,91858
4Anthropic Dreams9,91743
5Contenders9,88331

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

pmdpmd's picture
User offline. Last seen 1 year 42 weeks ago. Offline
Joined: 07/15/2014
Hello. I've counted 12 residues

Have a nice day

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons