puzzle picture
1119: Revisiting Puzzle 84: Giant Anemone
Status: Closed

Summary

Name: 1119: Revisiting Puzzle 84: Giant Anemone
Status: Closed
Created: 07/27/2015
Points: 100
Expired: 08/04/2015 - 11:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,236100
2Go Science9,18981
3Beta Folders9,18764
4L'Alliance Francophone9,18050
5Gargleblasters9,17939

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons