puzzle picture
1116: Revisiting Puzzle 83: Cardiotoxin
Status: Closed

Summary

Name: 1116: Revisiting Puzzle 83: Cardiotoxin
Status: Closed
Created: 07/21/2015
Points: 100
Expired: 07/28/2015 - 11:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,493100
2Go Science9,31178
3Anthropic Dreams9,31060
4Contenders9,27545
5Gargleblasters9,26533

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons