puzzle picture
1061: De-novo Freestyle 49: Hand-folding Round
Status: Closed

Summary

Name: 1061: De-novo Freestyle 49: Hand-folding Round
Status: Closed
Created: 03/09/2015
Points: 100
Expired: 03/16/2015 - 23:00
Difficulty: Intermediate
Description: In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.
Categories: Hand-Folding, Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,253100
2Anthropic Dreams9,21282
3Beta Folders9,17766
4Gargleblasters9,15653
5Void Crushers8,95542

Top Soloists



Need this puzzle? Log in to download.  

Comments

bkoep's picture
User offline. Last seen 12 hours 40 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
SAM secondary structure predictions unavailable

The SAM server is out of commission for the foreseeable future, sorry!

Joined: 11/24/2014
 

It's

veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd

in case anyone wants to run their own secondary structure predictions.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons