puzzle picture
1511: Unsolved De-novo Freestyle 129
Status: Closed

Summary

Name: 1511: Unsolved De-novo Freestyle 129
Status: Closed
Created: 04/20/2018
Points: 100
Expired: 04/27/2018 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,681100
2Beta Folders10,67265
3Go Science10,56041
4Gargleblasters10,53624
5L'Alliance Francophone10,46214

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Galaxie 2 2 Anthropic Dreams10,679100
2retiredmichael 12 3 Beta Folders10,65097
3grogar7 71 25 Anthropic Dreams10,64093
4eusair 71 111  10,63089
5fiendish_ghoul 71 5  10,62285


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons